PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G158200.1.p
Common NameGLYMA_12G158200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family FAR1
Protein Properties Length: 295aa    MW: 34746.8 Da    PI: 4.9797
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G158200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR131.17.9e-10102157259
                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetr 59 
                          fY+ YAk +GFs+rks+  ++ + +e+ ++tf Cs+ g+r+++ +++ ++r++r++++
  Glyma.12G158200.1.p 102 FYCWYAKITGFSIRKSHIVRN-TCRETLQQTFFCSCAGYRRHKGSTS-NRRKRREKKK 157
                          9****************9999.66779***************99982.2222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.3E-7102158IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MESSDNFCRF VNGDGDNDVT EVYENDHADE DDVRLEDEEE VDSEVHNDDY GDYDDFWIPD  60
LFKEECISID TVVDIREFDM EKITVEDVSR LDFAELELAY LFYCWYAKIT GFSIRKSHIV  120
RNTCRETLQQ TFFCSCAGYR RHKGSTSNRR KRREKKKESR KMSATDIMQI ENYRKVGIRP  180
LHMYAAFANH CGGYDKVGFI RKDIYNQEVH MRKQHTSDAS GALKYLHDLR KKDPIMYVSY  240
TMDEGSRLQR LLWCDIESQL LYEAFDDVLA FDATYKKNKY LCPFVVFSGV NHYN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1149154RKRREK
2149157RKRREKKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2351391e-146AC235139.1 Glycine max strain Williams 82 clone GM_WBa0065P04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006603498.11e-151PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLK7LUT50.0K7LUT5_SOYBN; Uncharacterized protein
STRINGGLYMA12G18636.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3265734
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-14FAR1-related sequence 5